General Information

  • ID:  hor006555
  • Uniprot ID:  P61312
  • Protein name:  Adrenomedullin-2
  • Gene name:  Adm2
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Adrenomedullin family
  • Source:  Animal
  • Expression:  Expression was restricted to the intermediate and anterior lobes of the pituitary.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0044877 protein-containing complex binding
  • GO BP:  GO:0001525 angiogenesis; GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0010460 positive regulation of heart rate; GO:0010628 positive regulation of gene expression; GO:0045766 positive regulation of angiogenesis; GO:0045776 negative regulation of blood pressure
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY
  • Length:  47(99-145)
  • Propeptide:  MAQLLMVTVTFGCISLLYLLPGTLSGSLGKGLRPREPPAKIPSSGPQPGHPSLRPVVWKPPHALQPQGRGNPALATVHLPQGGGSRHPGPQRHVGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSYG
  • Signal peptide:  MAQLLMVTVTFGCISLLYLLPGTLS
  • Modification:  T47 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Adrenomedullin-2]: May play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-P61312-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006555_AF2.pdbhor006555_ESM.pdb

Physical Information

Mass: 604061 Formula: C226H362N74O65S2
Absent amino acids: EFIKM Common amino acids: LS
pI: 9.59 Basic residues: 8
Polar residues: 14 Hydrophobic residues: 14
Hydrophobicity: -44.89 Boman Index: -9688
Half-Life / Aliphatic Index: >20 hour Aliphatic Index: 84.89
Instability Index: 5752.13 Extinction Coefficient cystines: 7115
Absorbance 280nm: 154.67

Literature

  • PubMed ID:  14706825
  • Title:  Identification of novel adrenomedullin in mammals: a potent cardiovascular and renal regulator.
  • PubMed ID:  14615490
  • Title:  Intermedin is a calcitonin/calcitonin gene-related peptide family peptide acting through the calcitonin receptor-like receptor/receptor activity-modifying pro
  • PubMed ID:  26479776
  • Title: